DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and ST14

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:243 Identity:72/243 - (29%)
Similarity:112/243 - (46%) Gaps:27/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENS-----VIVAGSHDIHDQKGE 151
            |:.||:..:    |..|.|..::|:.:|:::||||....:....|     ....|.||  ..:..
Human   627 PWQVSLHAL----GQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHD--QSQRS 685

  Fly   152 ASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ---PEGYGT-LY 212
            |..:|.|.:...:.|..:......|||||:..::|..:.:.|:|..||  ||.   |.|... :.
Human   686 APGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLP--DASHVFPAGKAIWVT 748

  Fly   213 GWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGP 277
            |||:.........  .||:..:.:::...||.:|.:...|   ..:|.|.|:|||..|..|||||
Human   749 GWGHTQYGGTGAL--ILQKGEIRVINQTTCENLLPQQITP---RMMCVGFLSGGVDSCQGDSGGP 808

  Fly   278 LIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325
            |.....:....||    |:||||. .|.|:|.|.|:.|:..|.:||.:
Human   809 LSSVEADGRIFQA----GVVSWGD-GCAQRNKPGVYTRLPLFRDWIKE 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/243 (30%)
Tryp_SPc 84..323 CDD:214473 70/239 (29%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 72/243 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.