DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and zgc:123295

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:260 Identity:80/260 - (30%)
Similarity:123/260 - (47%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 APRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVE 134
            ||..|    |.:..:.|...|.|:.||:|  :|..| .|:|.|::||:.|:|:||||..  .::.
Zfish    30 APLNT----KIVGGQNAGAGSWPWQVSLQ--SPTYG-GHFCGGSLINKDWVLSAAHCFQ--DSIG 85

  Fly   135 NSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLP 199
            ..::..|   :..|.|.......:.:...:.|..|....|..||||:.....:.|:.|::|..|.
Zfish    86 TIMVKLG---LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLA 147

  Fly   200 EQDAQPEGY--GTL---YGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLC 259
               |....|  |||   .|||.:| :|....|..|||..:||:....|::  |..| .:....:|
Zfish   148 ---AAGNTYAAGTLSWVTGWGKLS-SAANQIPDILQEVEIPIVSHSDCKR--AYPG-EITSNMIC 205

  Fly   260 TGPL-TGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            .|.| .||...|..|||||::.:...:..:.     ||||:|: .|.:...|.|:.|||.:.:||
Zfish   206 AGLLDQGGKDSCQGDSGGPMVSRNGSQWIQS-----GIVSFGR-GCAEPGYPGVYARVSQYQDWI 264

  Fly   324  323
            Zfish   265  264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 76/246 (31%)
Tryp_SPc 84..323 CDD:214473 74/244 (30%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 75/249 (30%)
Tryp_SPc 36..264 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.