DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk13

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001034131.2 Gene:Klk13 / 626834 MGIID:3615275 Length:276 Species:Mus musculus


Alignment Length:326 Identity:92/326 - (28%)
Similarity:134/326 - (41%) Gaps:76/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLSTIASIMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHW 76
            |::|||.:.:.||...|.  ..|.:.....|.|              |.|....:.|        
Mouse     4 LVATIACLTLALSEGISR--DYPKILNGTNGTS--------------GFLPGGYTCL-------- 44

  Fly    77 TKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAG 141
                       |||.|:..::.:    :|.: .|.|.:::..|:||||||......|.     .|
Mouse    45 -----------PHSQPWQAALLI----RGRL-LCGGVLVHPKWVLTAAHCRKDGYTVH-----LG 88

  Fly   142 SHDI-HDQKGEASNIQMR---HIDY-----YVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPAT 197
            .|.: ..:.||.:...:|   |.:|     ::.|:        :||.|:..|.|:...::|:...
Mouse    89 KHALGRVENGEQAMEVVRSIPHPEYQVTPTHLNHD--------HDIMLLELKSPVQLSSHVRTLK 145

  Fly   198 LPEQDAQPEG-YGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTG 261
            |...|..|.| ...:.|||..:...| |||..||.||:.:...|.|.|:....   :....||.|
Mouse   146 LSADDCLPTGTCCRVSGWGTTTSPQV-NYPKTLQCANIELRSDEECRQVYPGK---ITANMLCAG 206

  Fly   262 PLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQV 326
            ...||...|..|||||||   |.      ..:.||:|||..||||.|.|.|:.|||.:..||.::
Mouse   207 TKEGGKDSCEGDSGGPLI---CN------GKLYGIISWGDFPCGQPNRPGVYTRVSKYLRWIREI 262

  Fly   327 I 327
            |
Mouse   263 I 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 78/251 (31%)
Tryp_SPc 84..323 CDD:214473 76/248 (31%)
Klk13NP_001034131.2 Tryp_SPc 39..262 CDD:238113 79/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.