DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG18735

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:261 Identity:72/261 - (27%)
Similarity:112/261 - (42%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHC-------LSSPQAVENS 136
            :.:..:|...|..|:::.:.....     .||..:::|:.:.||||||       |.:.:.:|  
  Fly    82 RIVGGQETEVHEYPWMIMLMWFGN-----FYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE-- 139

  Fly   137 VIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE- 200
                     |:::.....|..|.:...:.|..|.......|||||...||:.....:.|..:|. 
  Fly   140 ---------HNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP 195

  Fly   201 ------QDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSG-LPLHETNL 258
                  |.|...|:|.|...|.:|.|        |||..:|||..|.|..  :..| ..:.:..:
  Fly   196 SENYAGQTAVVTGWGALSEGGPISDT--------LQEVEVPILSQEECRN--SNYGESKITDNMI 250

  Fly   259 CTGPL-TGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEW 322
            |.|.: .||...|..|||||:......:.::.|    ||||||: .|.:.|||.|:.||.:|.:|
  Fly   251 CAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLA----GIVSWGE-GCAKPNAPGVYTRVGSFNDW 310

  Fly   323 I 323
            |
  Fly   311 I 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/256 (28%)
Tryp_SPc 84..323 CDD:214473 70/254 (28%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 70/259 (27%)
Tryp_SPc 83..314 CDD:238113 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.