DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG34458

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:275 Identity:72/275 - (26%)
Similarity:121/275 - (44%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEH 118
            ||....:|...::.:.:........:.:..:.|.|...|:.||:|:    .|. |:|.|::|::.
  Fly     6 NLVKLSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQL----NGR-HHCGGSLISDT 65

  Fly   119 WILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYT 183
            .|:|||||.......:...|| |::|:....|:..||..     ::.|..|......:|::||..
  Fly    66 MIVTAAHCTMGQNPGQMKAIV-GTNDLSAGNGQTFNIAQ-----FIIHPRYNPQSQDFDMSLIKL 124

  Fly   184 KEPLVFDTYVQPATLPEQDAQ--PEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQIL 246
            ..|:.....||...|.:.|:.  .:....:.|:|.::...  ..|:||:.|.:.:...:.|..  
  Fly   125 SSPVPMGGAVQTIQLADSDSNYAADTMAMISGFGAINQNL--QLPNRLKFAQVQLWSRDYCNS-- 185

  Fly   247 ARSGLP-LHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAP 310
              ..:| |.:..:|.|..:|.||.|..||||||...         ..:.|:|||| ..||.|..|
  Fly   186 --QNIPGLTDRMVCAGHPSGQVSSCQGDSGGPLTVD---------GKLFGVVSWG-FGCGAKGRP 238

  Fly   311 SVFVRVSAFTEWINQ 325
            :::..|.|...||.|
  Fly   239 AMYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 69/245 (28%)
Tryp_SPc 84..323 CDD:214473 66/241 (27%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 66/246 (27%)
Tryp_SPc 32..254 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.