DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:255 Identity:73/255 - (28%)
Similarity:121/255 - (47%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ATPHSAPYVVSIQMMTPDQGLV-HYCAGTIINEHWILTAAHCL--SSPQAVENSVIVAGSHDIHD 147
            ||..:.|::||:      ||.. |:|.|::||..|:||||||:  .:|.::   ::..|....:.
Zfish    42 ATHGAWPWMVSL------QGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSI---IVYLGKWRSYV 97

  Fly   148 QKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ-PEGYGT- 210
            ....:.:..:|||   :.|..|.......||||:.....:.:..|::|..|.::::. |.|..: 
Zfish    98 ADVNSISRTIRHI---IPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLADENSNFPRGTNSW 159

  Fly   211 LYGWGNVSM-----------TAVP-NYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPL 263
            :.|||::.:           .:|| .:|..||||.:.:.....|..|......|   ..:|.|..
Zfish   160 VAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHGRITP---NMICAGTR 221

  Fly   264 TGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            .||.:..:.||||||:.:|      ...:..|::|.| ..|.|.|.|.||:|||.:.:||
Zfish   222 PGGKATFSGDSGGPLMTKC------SVWVQAGVLSHG-YGCAQPNLPEVFIRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/255 (29%)
Tryp_SPc 84..323 CDD:214473 71/253 (28%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 71/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.