DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and tmprss5

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:228 Identity:75/228 - (32%)
Similarity:113/228 - (49%) Gaps:18/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 HYCAGTIINEHWILTAAHCLSS---PQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELY 169
            |.|.|:||...||:|||||:.:   || |.:.|:.||.  |.....:.:..|...::..:.::.|
Zfish   335 HICGGSIITNQWIVTAAHCVHNYRLPQ-VPSWVVYAGI--ITSNLAKLAQYQGFAVERIIYNKNY 396

  Fly   170 LGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGT---LYGWGNVSMTAVPNYPHRLQE 231
            ....:..||||:..|.||.|...::|..||:.|....| ||   :.|||......| ..|..|:|
Zfish   397 NHRTHDNDIALVKLKTPLNFSDTIRPVCLPQYDHDLPG-GTQCWISGWGYTQPDDV-LIPEVLKE 459

  Fly   232 ANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGI 296
            |.:|::..:.|......:| .:....||.|...|.|..|..||||||:   |::  |....::|:
Zfish   460 APVPLISTKKCNSSCMYNG-EITSRMLCAGYSEGKVDACQGDSGGPLV---CQD--ENVWRLVGV 518

  Fly   297 VSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329
            |||| ..|.:.|.|.|:.:|:.|..||..:|.:
Zfish   519 VSWG-TGCAEPNHPGVYSKVAEFLGWIYDIIES 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 74/223 (33%)
Tryp_SPc 84..323 CDD:214473 72/220 (33%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 72/220 (33%)
Tryp_SPc 312..547 CDD:238113 74/223 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.