DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and KLK10

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:248 Identity:78/248 - (31%)
Similarity:114/248 - (45%) Gaps:40/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASN 154
            |.|:.||:     ..||..:|||.::::.|:||||||.:.|....     .|...:...:||   
Human    56 SQPWQVSL-----FNGLSFHCAGVLVDQSWVLTAAHCGNKPLWAR-----VGDDHLLLLQGE--- 107

  Fly   155 IQMRHIDYYVRHELYLGGVNP--------YDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTL 211
             |:|.....|.|..|..|..|        :|:.|:....|:|....|:...||.:.|||.....:
Human   108 -QLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQV 171

  Fly   212 YGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETN--LCTGPLTGGVSICTADS 274
            .|||..:...| .|...|..:::.||..:.||..     .|...||  :|.| |..|...|.:||
Human   172 AGWGTTAARRV-KYNKGLTCSSITILSPKECEVF-----YPGVVTNNMICAG-LDRGQDPCQSDS 229

  Fly   275 GGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ||||:   |:|..:      ||:|||..|||....|:|:.::..:..|||:||
Human   230 GGPLV---CDETLQ------GILSWGVYPCGSAQHPAVYTQICKYMSWINKVI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 76/245 (31%)
Tryp_SPc 84..323 CDD:214473 73/242 (30%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 76/245 (31%)
Tryp_SPc 49..269 CDD:214473 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.