DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and KLK7

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_005037.1 Gene:KLK7 / 5650 HGNCID:6368 Length:253 Species:Homo sapiens


Alignment Length:221 Identity:64/221 - (28%)
Similarity:100/221 - (45%) Gaps:27/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGE--ASNIQMRHIDYYVRHELYLG 171
            :|.|.::||.|:||||||..:...|.     .||..:.|::.:  .::...||..|..:..    
Human    54 HCGGVLVNERWVLTAAHCKMNEYTVH-----LGSDTLGDRRAQRIKASKSFRHPGYSTQTH---- 109

  Fly   172 GVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPI 236
             ||  |:.|:.........:.|:...||.:...|....|:.|||..:...| .:|..|...::.:
Human   110 -VN--DLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDV-TFPSDLMCVDVKL 170

  Fly   237 LDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGK 301
            :..:.|.::....   |..:.||.|......:.|..||||||:   |....:      |:||||.
Human   171 ISPQDCTKVYKDL---LENSMLCAGIPDSKKNACNGDSGGPLV---CRGTLQ------GLVSWGT 223

  Fly   302 MPCGQKNAPSVFVRVSAFTEWINQVI 327
            .||||.|.|.|:.:|..||:|||..:
Human   224 FPCGQPNDPGVYTQVCKFTKWINDTM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 64/218 (29%)
Tryp_SPc 84..323 CDD:214473 61/215 (28%)
KLK7NP_005037.1 Tryp_SPc 29..245 CDD:214473 61/215 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.