DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Prss53

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:233 Identity:58/233 - (24%)
Similarity:103/233 - (44%) Gaps:33/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 DQGLVHY----CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYY 163
            |..|.|:    |.|.:::|..:||||||....|.:|...:..|:..  ::.|         :...
  Rat   354 DARLKHHGKLACGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGAGP--EEWG---------LKQL 407

  Fly   164 VRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ-PEGYGTLYGWG-NVSMTAVPNYP 226
            :.|..|......:|:|.:...:|:.....::|..||..|.: |:|.   :||. .::..|..|:|
  Rat   408 ILHGAYTHPEGGHDVAFLLLAQPVTLGPGLRPLCLPYADHRLPDGE---HGWVLGLTREAGINHP 469

  Fly   227 HRLQEANMPILDMELCEQILARS---GLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFE 288
            |.:.   :.:|....|.:..|.|   |:|:....:|| .:.|....|...||.||:.:.....| 
  Rat   470 HTVP---VTVLGPMACSRQHAASGSTGVPILPGMICT-TVVGEPPHCEGLSGAPLVHEIRGTWF- 529

  Fly   289 QANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQV 326
                :.|:.|:|. .|.....|:||..:||:.:|::.:
  Rat   530 ----LAGLHSFGD-TCQGSAKPAVFAALSAYEDWVSNL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 58/231 (25%)
Tryp_SPc 84..323 CDD:214473 57/228 (25%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 58/230 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.