DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Prss36

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:276 Identity:83/276 - (30%)
Similarity:122/276 - (44%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCL----SSPQAVENSV 137
            :.:.:...:|.|.:.|:.||:.     .|..|.|.|::|...|:|:||||.    :...|.|.||
  Rat    56 SSRIVGGSDAHPGTWPWQVSLH-----HGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADEWSV 115

  Fly   138 IVAGSHDIHDQKGEASNIQMRHI------DYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPA 196
            ::.    :|.|.|......||.:      |.|.|.||   |.   |:||:....|......|:|.
  Rat   116 LLG----VHSQDGPLEGAHMRSVATILVPDNYSRVEL---GA---DLALLRLASPAKLGPSVKPV 170

  Fly   197 TLPEQDAQPEGYGT---LYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSG-----LPL 253
            .|| :.:....:||   ..|||:|..:.....|..|||..:.:|....|:.:.:|.|     |.|
  Rat   171 CLP-RASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQL 234

  Fly   254 HETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSA 318
            ....||.|...|....|..||||||:   ||:....  .:.||.|:| ..||::|.|.||..|:.
  Rat   235 LPGMLCAGYPEGRRDTCQGDSGGPLV---CEDGGRW--FLAGITSFG-FGCGRRNRPGVFTAVAH 293

  Fly   319 FTEWINQVISTATHIM 334
            :..||.:      |:|
  Rat   294 YESWIRE------HVM 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 81/259 (31%)
Tryp_SPc 84..323 CDD:214473 79/256 (31%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 81/269 (30%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.