DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and zgc:92590

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:256 Identity:84/256 - (32%)
Similarity:119/256 - (46%) Gaps:36/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIV-AGS 142
            |.:...|.:|:|.|:.:   .:|.|.| ..:|..::||:.|.::||||    ..|.|.:.| .|.
Zfish    20 KIIGGYECSPNSQPWQI---YLTYDNG-QRWCGASLINDRWAVSAAHC----YLVANRLTVHLGE 76

  Fly   143 HDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPY----DIALIYTKEPLVFDTYVQPATLPEQDA 203
            |::..::|....|:...:   :.|..|    |.|    |..||..|||.||:.||||..| ....
Zfish    77 HNVAVEEGTEQRIKAEKV---IPHPKY----NDYTLDNDFMLIKLKEPAVFNQYVQPVPL-TTSC 133

  Fly   204 QPEGYGTLY-GWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGV 267
            ..||...|. ||||:..|.|. ||..||..|:|:|....||   ...|..:.:...|.|.:.||.
Zfish   134 SSEGEQCLVSGWGNLINTGVV-YPDVLQCLNLPVLTRAQCE---GAYGWQITKNMFCAGFMEGGK 194

  Fly   268 SICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
            ..|..|||||:|  |..|       :.|:|||| ..|.....|.|:..|..:|:|:...|:
Zfish   195 DACQGDSGGPVI--CNGE-------LRGVVSWG-YGCADSGYPGVYTEVCRYTDWVASTIA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 82/247 (33%)
Tryp_SPc 84..323 CDD:214473 81/244 (33%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 82/249 (33%)
Tryp_SPc 21..243 CDD:238113 82/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.