DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and st14

DIOPT Version :10

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_012821897.2 Gene:st14 / 448647 XenbaseID:XB-GENE-1008784 Length:845 Species:Xenopus tropicalis


Alignment Length:106 Identity:28/106 - (26%)
Similarity:43/106 - (40%) Gaps:19/106 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TGAILIAVFHIILCSGIFT-----W------LVKC---IATEKSRIELAAEI---FLASLCLIAA 89
            |||.|..:. ..|.|.:.|     |      |..|   :|...|||.:.|..   .||.|...|.
 Frog     3 TGAALWPIM-TALSSQVATRARSRWVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGAV 66

  Fly    90 IILLLGLKLESRRLLTGYVL-AQTLLVGLLFVLFLALIMGI 129
            :..|:..::...|.|:.|.| |..|::|...:.:....:|:
 Frog    67 LGWLMTPRVPMERELSFYGLTALALMLGTSLIYWTLFTLGL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 11/47 (23%)
st14XP_012821897.2 SEA 76..167 CDD:460188 8/32 (25%)
CUB 216..320 CDD:238001
CUB 328..432 CDD:238001
LDLa 442..474 CDD:238060
LDLa 476..511 CDD:238060
LDLa 513..547 CDD:238060
LDLa 554..587 CDD:197566
Tryp_SPc 604..839 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.