DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and prss36

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:285 Identity:78/285 - (27%)
Similarity:128/285 - (44%) Gaps:35/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ISTLEAPRQTH---WTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHC 126
            :||..||....   .:.:.:...:|...:.|:.||::....     |.|.|::|...||||||||
 Frog    19 VSTTPAPPSCGSPLVSSRIVGGTDAREGAWPWQVSLRYRGS-----HICGGSVIGTQWILTAAHC 78

  Fly   127 LSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRH----EL-YLGGVNPYDIALIYTKEP 186
            ..:.|:..:..:..|::.:.:   .:.|.....:|..:.|    || |.|     |||||....|
 Frog    79 FGNSQSPSDYEVRLGAYRLAE---TSPNEITAKVDRIIMHPQYDELTYFG-----DIALIRLTSP 135

  Fly   187 LVFDTYVQPATLPE-QDAQPEGYGT-LYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQI---- 245
            :.:..|:.|..||. .::..:|... :.|||..:......:|..|||...|:::...|:|:    
 Frog   136 IDYTAYILPVCLPSASNSFTDGMECWVTGWGKTAFNVNLPFPGTLQEVMTPLINRTRCDQMYHID 200

  Fly   246 --LARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKN 308
              ::.|...:....:|:|...||...|..||||.|:   |:  .::....|||||||. .|...|
 Frog   201 SPVSASSEIIPSDQICSGYSDGGKDSCKGDSGGALV---CK--IQRVWYQIGIVSWGD-GCAIAN 259

  Fly   309 APSVFVRVSAFTEWINQVISTATHI 333
            .|.|:..|.|:..|::...:|...|
 Frog   260 RPGVYTLVPAYQSWLSSYNATENTI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/254 (28%)
Tryp_SPc 84..323 CDD:214473 71/251 (28%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113 72/257 (28%)
Tryp_SPc 385..622 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.