DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and cela1.5

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001003450.1 Gene:cela1.5 / 445056 ZFINID:ZDB-GENE-040801-186 Length:274 Species:Danio rerio


Alignment Length:286 Identity:92/286 - (32%)
Similarity:137/286 - (47%) Gaps:48/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LAAYGLLENRISTLEAPRQTHWTKKFLAKRE-------ATPHSAPYVVSIQMMTPDQ-GLVHYCA 111
            |||:.|.|        ||..    |.||..|       |.|||.|:.||:|:.|..| ...||||
Zfish    10 LAAFALAE--------PRYV----KDLAAEERVVGGEIAKPHSWPWQVSVQIKTLSQDSYTHYCA 62

  Fly   112 GTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNP- 175
            ||:|.::::||:.|.:.|...  :..:|.|.|||...:|....|::|.|.::...:  |..|:. 
Zfish    63 GTLIRKNYVLTSVHSIFSKYG--SWRVVLGDHDISTDEGTEQYIEVREITFHAYSD--LNDVSKG 123

  Fly   176 YDIALIYTKEPLVFDTYVQPATLP-EQDAQPEG---YGTLYGWGNVSMTAVPNYPHRLQEANMPI 236
            .|:||:........:.|||.|.|| .:...|.|   :.|  ||||.....  ::...|::|.:|:
Zfish   124 NDVALLKLASDANLNAYVQLAPLPRHKQILPHGTPCFTT--GWGNTETDG--SFSAELKQAYLPV 184

  Fly   237 LDMELCEQILARS---GLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVS 298
            :|.|.|.|    |   |..:.:|.:|.|  .|.:::|..|.||||  .|.   .:...:|.||.|
Zfish   185 VDHETCSQ----SDWWGSTVKDTMVCGG--DGTMAVCKGDFGGPL--SCL---VDGKYVVYGIAS 238

  Fly   299 W-GKMPCGQKNAPSVFVRVSAFTEWI 323
            : ....|.....|::|.||||:.:||
Zfish   239 FMSSEGCNIYKKPTIFTRVSAYVDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 82/257 (32%)
Tryp_SPc 84..323 CDD:214473 80/255 (31%)
cela1.5NP_001003450.1 Tryp_SPc 29..264 CDD:214473 79/253 (31%)
Tryp_SPc 30..264 CDD:238113 79/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.