DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and KLK14

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:249 Identity:65/249 - (26%)
Similarity:111/249 - (44%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSH 143
            |.:.....|..|.|:..:: :..|.:..:  |.|.:::..|::||||| ..|..    .:..|.|
Human    24 KIIGGHTCTRSSQPWQAAL-LAGPRRRFL--CGGALLSGQWVITAAHC-GRPIL----QVALGKH 80

  Fly   144 DIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGY 208
            ::  ::.||:. |:..:...|.|..|....:..|:.|:..::|......|:|..:.:..|.|...
Human    81 NL--RRWEATQ-QVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTS 142

  Fly   209 GTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTAD 273
            ..:.|||.:| :.:..||..||..|:.|...|:|::...|:..|   ..:|.|...||...|..|
Human   143 CRVSGWGTIS-SPIARYPASLQCVNINISPDEVCQKAYPRTITP---GMVCAGVPQGGKDSCQGD 203

  Fly   274 SGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            |||||:   |....:      |:||||...|.....|.|:..:..:..||.:.:
Human   204 SGGPLV---CRGQLQ------GLVSWGMERCALPGYPGVYTNLCKYRSWIEETM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 64/241 (27%)
Tryp_SPc 84..323 CDD:214473 62/238 (26%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 64/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.