DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and aqrs

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:351 Identity:71/351 - (20%)
Similarity:113/351 - (32%) Gaps:129/351 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLSYRCIYSVL-LSTIASIMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENR 64
            |.|.:.||.|:| :...||:.:   ...|.:...||..    .|:......:..|..|   ||.|
  Fly     1 MRLLFTCILSILGMDYSASLWI---KKYSENYHRPTYY----NRAHRTKDHVDYNREA---LEER 55

  Fly    65 ISTLEAPRQTHWTKK--FLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCL 127
                :.|:.....|:  |.|.|:.|     |.|::.    ::|.| .|||.:|:...::|:.|| 
  Fly    56 ----DKPKPVEVQKRLPFDATRDLT-----YYVNVL----NEGSV-ICAGALISRRMVVTSTHC- 105

  Fly   128 SSPQAVENSVIVAGSHDIHDQKGEASNIQMRHID----YYVRHELYLGGV----NPYD------- 177
                                       .|.|..|    |..:|...|.||    ||..       
  Fly   106 ---------------------------FQPRRFDLIYEYTAKHLSILTGVELDDNPEPHQVIGFF 143

  Fly   178 ------------IALIYTKEPLVFDTYVQPATLPEQDAQPEG--------YGTLYGWGNVSMTAV 222
                        :||:.....|..|.|   ..:|....:|:.        ||.            
  Fly   144 MPVNKNERFTNYVALLALSNKLDRDKY---RYIPLHRKKPQAGDDVKMAYYGP------------ 193

  Fly   223 PNYPHRLQEANMPILDMELCEQILARSGLP--LHETN-----LCT-GPLTGGVSICTADSGGPLI 279
            |.:..||.  |..::|::.|:   ...||.  .|.:.     :|. .......:.|:...|.||:
  Fly   194 PKFQIRLY--NTRVMDIDRCK---IHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCSTRPGDPLL 253

  Fly   280 -----------QQCCEEHFEQANIVI 294
                       .:.|:|..:..|:.|
  Fly   254 IDNKLAAINIYGEHCDEDDDSTNMDI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 50/265 (19%)
Tryp_SPc 84..323 CDD:214473 50/265 (19%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 46/251 (18%)
Tryp_SPc 83..268 CDD:304450 42/233 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.