DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG31266

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:291 Identity:81/291 - (27%)
Similarity:128/291 - (43%) Gaps:35/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GAAHTMAMN---LAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLV 107
            |....|.|.   |.....:|...||...|:     .:.:....|...:.|::.|||    :....
  Fly    20 GPTEAMRMRGEPLPGLANIERHRSTEAVPQ-----GRVIGGTTAAEGNWPWIASIQ----NAYSY 75

  Fly   108 HYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGG 172
            |.|...|::|.|:||||.|::..:.: |.::|.|:.|..|.......:...|:.......||.. 
  Fly    76 HLCGAIILDETWVLTAASCVAGLRPL-NLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHN- 138

  Fly   173 VNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYG-TLYGWGNVSMTAVPNYPHRLQEANMPI 236
                ||||:.....:.|:...:..||.:.|...||.. |..|||  |..|:..|...||||:...
  Fly   139 ----DIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWG--SSEAMGTYGRYLQEASGTY 197

  Fly   237 LDMELC-EQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWG 300
            |.::.| |::..:..:.|  .::|. .:..|...|..|:|||||.       ||..:| ||.:||
  Fly   198 LPVDACREKLQNQDDVDL--GHVCV-QMDAGQGACHGDTGGPLID-------EQQRLV-GIGNWG 251

  Fly   301 KMPCGQKNAPSVFVRVSAFTEWINQVISTAT 331
             :||| :..|.|:.|.:.:.:||...::..|
  Fly   252 -VPCG-RGYPDVYARTAFYHDWIRTTMNGCT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/243 (30%)
Tryp_SPc 84..323 CDD:214473 70/240 (29%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 70/245 (29%)
Tryp_SPc 52..275 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.