DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG14892

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:370 Identity:72/370 - (19%)
Similarity:120/370 - (32%) Gaps:149/370 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PYVVSIQMMTPDQG-LVHYCAGTIINEHWILTAAHCLSSPQAVENSV----------IVAGSHDI 145
            |:..|::::.|..| |.|:|...:|:::|||:||||      |.|.:          :|.|.||.
  Fly    93 PWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHC------VHNDLFNLPIPPLWTVVLGEHDR 151

  Fly   146 HDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEP-------------LVF-------- 189
            ..:.|....|.:..|..:.|:..:     .:|:.|:...:|             |.|        
  Fly   152 DVESGNEQRIPVEKIVMHHRYHNF-----KHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQ 211

  Fly   190 --------------DTYVQPATL------------------------------------------ 198
                          |..:|...|                                          
  Fly   212 AQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQ 276

  Fly   199 ------------------------PEQDA-------------QPEGYG----TLYGWGNVSMTAV 222
                                    |.:|:             :|:...    ...|||..:::. 
  Fly   277 ALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISG- 340

  Fly   223 PNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHF 287
             :..::|.:..:|:.....|..... |.:.:|..:||.|.|.|....|..||||||   .|....
  Fly   341 -DLSNQLLKTQVPLHQNGRCRDAYG-SFVNIHGGHLCAGKLNGEGGTCVGDSGGPL---QCRLSR 400

  Fly   288 EQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVISTATH 332
            :...|::|:.|:|. .|..:..|.|:.|.|.:.:||...|  |||
  Fly   401 DGPWILVGVTSFGS-GCALEGFPDVYTRTSYYMKWIEDTI--ATH 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/362 (19%)
Tryp_SPc 84..323 CDD:214473 66/359 (18%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 66/359 (18%)
Tryp_SPc 81..438 CDD:238113 68/362 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.