DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG17404

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:269 Identity:86/269 - (31%)
Similarity:124/269 - (46%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TPH------------SAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIV 139
            |||            ..||.||:|..|.. |.:|:|.|:||..:.|||||||.....|...|| |
  Fly    31 TPHRIVGGADIPPGEHVPYQVSLQYRTRG-GQMHFCGGSIIAPNRILTAAHCCQGLNASRMSV-V 93

  Fly   140 AGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ 204
            ||...: ::||..|.:    :.|.: |..|...|.. |:|::..|.||..:.    :|:...:.:
  Fly    94 AGIRGL-NEKGSRSQV----LSYSI-HPKYQELVTS-DLAVLSIKPPLKLNN----STISAIEYR 147

  Fly   205 PEGYG--------TLYGWGNVSMTAVP-----NYPHRLQEANMPILDMELCEQILARSGLPLHET 256
            .:|..        ||.|||.......|     |||:.||..:...:....|......|   :.:|
  Fly   148 SQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGMES---VTDT 209

  Fly   257 NLCT-GPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFT 320
            .:|. ||..|.   |:.||||||:.: .:...:|    :||||:|.:.||...:|.|:.|||.|:
  Fly   210 EICARGPFRGA---CSGDSGGPLVME-SKNGLQQ----VGIVSYGLVVCGLYISPDVYTRVSTFS 266

  Fly   321 EWI-NQVIS 328
            :|| ||..|
  Fly   267 DWIGNQTKS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 84/265 (32%)
Tryp_SPc 84..323 CDD:214473 81/261 (31%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 78/258 (30%)
Tryp_SPc 35..269 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.