DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG12951

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:253 Identity:82/253 - (32%)
Similarity:119/253 - (47%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQ 156
            |:|||::.....    |.|.|:||::|:::|||||.:...| :...|..|..:|.........|:
  Fly    42 PFVVSLRSYDGS----HSCGGSIISKHFVMTAAHCTNGRPA-DTLSIQFGVTNISAMGPNVVGIK 101

  Fly   157 --MRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFD-TYVQPATL-------PEQDAQPEGYGTL 211
              ::|.|:....:      |..||:|:..:||..|| ..|.|..|       |:.||..|  |.|
  Fly   102 KIIQHEDFDPTRQ------NANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVE--GVL 158

  Fly   212 YGWG-NVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSG 275
            .||| |.:..:|.:   .|||.::.|...|.|..  ..:|....:.::|.|...||...|:.|||
  Fly   159 IGWGLNDTYGSVQD---TLQEVSLKIYSDEECTS--RHNGQTDPKYHICGGVDEGGKGQCSGDSG 218

  Fly   276 GPLI---QQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI--NQVIS 328
            ||||   ||            :|||||...||.....|.|:.:||.:.:||  ||:||
  Fly   219 GPLIYNGQQ------------VGIVSWSIKPCTVAPYPGVYCKVSQYVDWIKSNQIIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 79/249 (32%)
Tryp_SPc 84..323 CDD:214473 76/244 (31%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 76/244 (31%)
Tryp_SPc 30..260 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.