DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk1c6

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:257 Identity:68/257 - (26%)
Similarity:113/257 - (43%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEAS 153
            :|.|:.|::...:       .|.|.:|:..|::|||||.|:  |:....::.|.:::.:.:..| 
  Rat    34 NSQPWQVAVISRS-------LCGGVLIDPSWVITAAHCYSN--ALSYYHVLLGRNNLSEDEPFA- 88

  Fly   154 NIQMRHIDYYVRHELYLGGVNPY---------------DIALIYTKEPLVFDTYVQPATLPEQDA 203
              |.|.:.....|..|    ||:               |:.|::..:|......|:...||.::.
  Rat    89 --QYRFVSQSFPHPDY----NPFFMRNHTRQPGDDYSNDLMLLHLSKPADITDGVKVIDLPTEEP 147

  Fly   204 QPEGYGTLYGWGNVSMTAVP---NYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTG 265
            :........|||:..    |   ..|..||..|:.:|..|.|.:.....   :.:..||.|.|.|
  Rat   148 KVGSTCLASGWGSTK----PLDWELPDDLQCVNIHLLSNEKCIEAYNEK---VTDLMLCAGDLEG 205

  Fly   266 GVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            |...|..|||||||   |:      .::.||.|||..||.:.|.|:::.::..||.||.:|:
  Rat   206 GKDTCKGDSGGPLI---CD------GVLQGITSWGSDPCAEPNMPAIYTKLIKFTSWIKEVM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 67/254 (26%)
Tryp_SPc 84..323 CDD:214473 65/251 (26%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.