DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG11037

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:100/225 - (44%) Gaps:34/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVN 174
            |.||::||:.:||||||..........::.||..:: :|||     ..||:..::..|.:.....
  Fly    88 CGGTLLNENIVLTAAHCFLGRMKASEWIVAAGISNL-NQKG-----IRRHVKDFILSEQFREDDM 146

  Fly   175 PYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNY-PHR-LQEANMPIL 237
            ..|:|::..|.||.... :...:|.....:|.....:.|||   |||.... ||. |:...:||:
  Fly   147 NMDVAVVLLKTPLKAKN-IGTLSLCSVSLKPGVELVVSGWG---MTAPRGRGPHNLLRTVTVPII 207

  Fly   238 DMELCE---QILARSGLPLHETNLCTGPLTGGVSICTADSGGPLI--QQCCEEHFEQANIVIGIV 297
            ..:.|.   |..|:    :.::.:|...| |....||.||||||:  :|.|           |||
  Fly   208 HKKNCRAAYQPTAK----ITDSMICAAVL-GRKDACTFDSGGPLVFKKQVC-----------GIV 256

  Fly   298 SWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            |:| :.|.....|.|:..|.....:|.:.|
  Fly   257 SFG-IGCASNRYPGVYTDVMYVKPFIEKSI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 63/222 (28%)
Tryp_SPc 84..323 CDD:214473 62/219 (28%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 62/219 (28%)
Tryp_SPc 62..283 CDD:238113 63/221 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.