DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG6865

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:275 Identity:82/275 - (29%)
Similarity:130/275 - (47%) Gaps:53/275 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSS-------PQAVENS 136
            |.:...||..:..||:||:.....     |:|.||||:|.|||||.||:.:       |..::. 
  Fly    34 KIVGGSEAERNEMPYMVSLMRRGG-----HFCGGTIISERWILTAGHCICNGLQQFMKPAQIQG- 92

  Fly   137 VIVAGSHDIHDQ-KGEASNIQMRHIDY--YVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATL 198
              |.|.|.|.:. .|..:......:|:  .|.|..|......:||||:...:|:.|.:::||:.:
  Fly    93 --VVGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCV 155

  Fly   199 PEQDAQ---PEGYGTLYGWGNVSMTAVPNYPHR----------LQEANMPILDMELCE---QILA 247
            ..::..   .:.|||:.|||         :.|.          |::|.:.|.:.|.||   :.|.
  Fly   156 GSEEGHRSLEQEYGTVSGWG---------WTHENQAENDRSDVLRKATVKIWNNEACERSYRSLG 211

  Fly   248 RSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSV 312
            :|. .:.||.||.|...|.:..|.|||||||:.:  |.|      ::|:||.| :.|.:...|.:
  Fly   212 KSN-TIGETQLCAGYENGQIDSCWADSGGPLMSK--EHH------LVGVVSTG-IGCARPGLPGI 266

  Fly   313 FVRVSAFTEWINQVI 327
            :.|||.:..|:.:||
  Fly   267 YTRVSKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 79/267 (30%)
Tryp_SPc 84..323 CDD:214473 78/264 (30%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 79/268 (29%)
Tryp_SPc 35..280 CDD:238113 79/271 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.