DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG10663

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:130/304 - (42%) Gaps:56/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQ 98
            |....||..||.....:|:..|...|        ..|.|:..|               |:.|:|.
  Fly   484 PLKLSCGIVRSGTGRRSMSNMLKIIG--------GRAARKGEW---------------PWQVAIL 525

  Fly    99 MMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYY 163
            ....:.    :|.||:|...|:||||||:.....|.     .|.|:::.:.|  :.||:|.:..|
  Fly   526 NRFKEA----FCGGTLIAPRWVLTAAHCVRKVLFVR-----IGEHNLNYEDG--TEIQLRVMKSY 579

  Fly   164 VRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQ-DAQPEGYG-TLYGWG-----NVSMTA 221
            . |..:.......|:||:...:.:...|::..:.||:. .|.|:... |:.|||     :.:.|:
  Fly   580 T-HPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDCTIIGWGKRRNRDATGTS 643

  Fly   222 VPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEH 286
            |      |.:|.:||:.|:.|.::.  ....:.:...|.|...|.:..|..||||||:   |.:.
  Fly   644 V------LHKATVPIIPMQNCRKVY--YDYTITKNMFCAGHQKGHIDTCAGDSGGPLL---CRDT 697

  Fly   287 FEQAN--IVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
            .:..:  .:.||.|:|. .|.|:|...::.:|..:.:|:..|::
  Fly   698 TKPNHPWTIFGITSFGD-GCAQRNKFGIYAKVPNYVDWVWSVVN 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 63/250 (25%)
Tryp_SPc 84..323 CDD:214473 62/247 (25%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 66/275 (24%)
Tryp_SPc 507..735 CDD:238113 66/274 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.