DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and ovch1

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_956439.2 Gene:ovch1 / 393114 ZFINID:ZDB-GENE-040426-834 Length:556 Species:Danio rerio


Alignment Length:252 Identity:80/252 - (31%)
Similarity:129/252 - (51%) Gaps:32/252 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLS--SPQAVENSVIVAG 141
            :.:..:||..||.|:.||:|...     |..|.|.|:::.|::||.||..  ...::.|:|:  |
Zfish    56 RIIGGKEAWAHSWPWQVSLQYND-----VPTCGGAILDQLWVITAGHCFKRYKKPSMWNAVV--G 113

  Fly   142 SHDIHDQKGEAS--NIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQ 204
            .|:: |...|:|  :||::.|   ..|:.|....|..||||:..:.||||..:|:|..:...|..
Zfish   114 LHNL-DNANESSRESIQVQKI---FSHKNYNQKTNENDIALLKLQSPLVFSKFVRPIGVFNNDLP 174

  Fly   205 PEGYGTLYGWGNVSMTAVPNYPH--RLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGV 267
            |....|:.|||:|:    .|.|.  ||||.|:.:.:.:.|.:......|   ::.:|.|...||:
Zfish   175 PLVTCTVTGWGSVT----ENGPQASRLQEVNVTVYEPQKCNRFYRGKVL---KSMICAGANEGGM 232

  Fly   268 SICTADSGGPLIQQCCE-EHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            ..|..||||||  .|.: |.::.|    |:|||| :.||:...|.|:..:..:.:|:
Zfish   233 DACQGDSGGPL--SCFDGERYKLA----GVVSWG-VGCGRAQKPGVYTTLYHYRQWM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 80/247 (32%)
Tryp_SPc 84..323 CDD:214473 79/245 (32%)
ovch1NP_956439.2 Tryp_SPc 56..281 CDD:214473 79/249 (32%)
Tryp_SPc 57..281 CDD:238113 79/248 (32%)
Tryp_SPc 331..551 CDD:238113
Tryp_SPc 331..549 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.