DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG4477

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:268 Identity:62/268 - (23%)
Similarity:114/268 - (42%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YVVSIQMMTPDQ--GLVHYCAGTIINEHWILTAAHCLSSPQAVENS----VIVAGSHDIHDQKGE 151
            |.||::..:.::  |..|:|:|.|:...:::|:||||.:.:.|..|    :||||:  ::..|  
  Fly    53 YCVSLRSRSAEKFFGDNHFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGT--LNRLK-- 113

  Fly   152 ASNIQMRHIDYYVRHELYLGGV------------NPYDIALIYTKEPLVFDT-YVQPATLPEQDA 203
                       |:.:..::..|            |..|..|:..|.|...:. ::..|.||....
  Fly   114 -----------YIPNRTFVTPVTHIWLPDSFTMRNKQDFGLLKVKNPFPRNNEHISIARLPVHPP 167

  Fly   204 QP------EGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGP 262
            .|      .|:|.:|..|.::     :|   :...::.::|.|.|.:.|....:. |...:.:..
  Fly   168 LPGLKCKVMGWGRMYKGGPLA-----SY---MLYIDVQVIDSEACAKWLRVPSVE-HVCAVDSDD 223

  Fly   263 LTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ-V 326
            || ....|..|.|.|::..         ..|.|||:. ...||..:.||::..|.:...||:: :
  Fly   224 LT-AQQPCGGDWGAPMLHN---------GTVYGIVTI-LAGCGVSHLPSLYTNVHSNANWIHEKI 277

  Fly   327 ISTATHIM 334
            ||:|..|:
  Fly   278 ISSAGSIL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 58/258 (22%)
Tryp_SPc 84..323 CDD:214473 56/254 (22%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 57/255 (22%)
Tryp_SPc 55..273 CDD:214473 55/252 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.