DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG32271

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:100/244 - (40%) Gaps:38/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASN 154
            |.||:|::::     |....|.|:::....::|||||:....| ...::|||...: .:.|..|.
  Fly    35 SVPYLVNLRI-----GGNFMCGGSLVTPQHVVTAAHCVKGIGA-SRILVVAGVTRL-TETGVRSG 92

  Fly   155 IQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWGNVSM 219
                 :|.....:.|.......|:|::..|.| :....|....|.....:......:.|||.:: 
  Fly    93 -----VDKVYTPKAYNTRTLTSDVAVLKLKAP-ISGPKVSTIELCNTSFKAGDLIKVSGWGQIT- 150

  Fly   220 TAVPNYPHRLQEANMPI--LDMELCEQILARSGLPLH----ETNLCTGPLTGGVSICTADSGGPL 278
                   .|.:..:|.:  :|:.|..:....|...|.    .|..|.. :.|....|..|||||.
  Fly   151 -------ERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCAS-VPGVKDACEGDSGGPA 207

  Fly   279 IQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            :.|         ..:.|||||| :.|.:|::|.|:..|.....:|::.:
  Fly   208 VYQ---------GQLCGIVSWG-VGCARKSSPGVYTNVKTVRSFIDKAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 57/241 (24%)
Tryp_SPc 84..323 CDD:214473 56/238 (24%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 56/238 (24%)
Tryp_SPc 25..244 CDD:238113 57/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.