Sequence 1: | NP_650703.1 | Gene: | CG7142 / 42194 | FlyBaseID: | FBgn0038595 | Length: | 334 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001163264.1 | Gene: | CG30414 / 37705 | FlyBaseID: | FBgn0050414 | Length: | 305 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 61/260 - (23%) |
---|---|---|---|
Similarity: | 97/260 - (37%) | Gaps: | 71/260 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 CAGTIINEHWILTAAHCLSS-----------------------PQAVENSVIVAGSHDIH----- 146
Fly 147 -----------DQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE 200
Fly 201 QDAQPEG-YGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLT 264
Fly 265 GGVSICTADSGGPLIQQCCEEHFEQANIVI--GIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
Fly 328 327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7142 | NP_650703.1 | Tryp_SPc | 84..326 | CDD:238113 | 60/257 (23%) |
Tryp_SPc | 84..323 | CDD:214473 | 58/254 (23%) | ||
CG30414 | NP_001163264.1 | Tryp_SPc | 41..290 | CDD:214473 | 58/254 (23%) |
Tryp_SPc | 41..290 | CDD:238113 | 58/254 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24256 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |