DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG30414

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:260 Identity:61/260 - (23%)
Similarity:97/260 - (37%) Gaps:71/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 CAGTIINEHWILTAAHCLSS-----------------------PQAVENSVIVAGSHDIH----- 146
            |.|::|...::||||||:.|                       |::.:...|..|.:|..     
  Fly    64 CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKD 128

  Fly   147 -----------DQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE 200
                       |:|       :.|.||.:..:        .||.|:..|..:.:..||:|..|..
  Fly   129 CCVPKSYELAVDRK-------ILHADYNLNLD--------NDIGLLRMKSFVQYSDYVRPICLLV 178

  Fly   201 QDAQPEG-YGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLT 264
            :....|. ...:.||| |:....|:  .|||.|.:...|:..|.....:.   :.|:.:|.....
  Fly   179 EGHMAESPIFNITGWG-VTNDGTPS--RRLQRATVYNTDLHFCRSKFTKQ---VDESQICAAGTN 237

  Fly   265 GGVSICTADSGGPLIQQCCEEHFEQANIVI--GIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            .  ..|..||||||..|.   .|..:.:..  |:||:|...|   ::.||:..|:...:||...|
  Fly   238 S--DACHGDSGGPLSAQV---PFAGSWLTFQYGLVSYGSAAC---HSFSVYTNVTHHRDWIVNAI 294

  Fly   328  327
              Fly   295  294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 60/257 (23%)
Tryp_SPc 84..323 CDD:214473 58/254 (23%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 58/254 (23%)
Tryp_SPc 41..290 CDD:238113 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.