DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG9294

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:362 Identity:90/362 - (24%)
Similarity:152/362 - (41%) Gaps:89/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SVLL---STIASIMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLE--------N 63
            |:||   :|..|..||.::::       |.|:.....|..:..|.:....|...:|        .
  Fly    36 SILLPSTTTTTSTPVVATTST-------TTRRTTTTSSTTSRTTTSRTTVANFPIERDCVTCRCG 93

  Fly    64 RISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVH---YCAGTIINEHWILTAAH 125
            .|:||         .|.:..:|...|..|::..|        |::   ||:|::||:.::|||||
  Fly    94 LINTL---------YKIVGGQETRVHQYPWMAVI--------LIYNRFYCSGSLINDLYVLTAAH 141

  Fly   126 CLSS--PQAVENSVIVAGSHDIHDQKGEASNIQM-RHIDYYVRHELYLGGVNP----YDIALIYT 183
            |:..  |:.:....:.      |::.....:|.: |::.....||||    ||    .|:|::..
  Fly   142 CVEGVPPELITLRFLE------HNRSHSNDDIVIQRYVSRVKVHELY----NPRSFDNDLAVLRL 196

  Fly   184 KEPLVFDTY-VQPATLPEQD-AQPEGYGTLYGWGNVSMTAVPNYPHR--------LQEANMPILD 238
            .:||....: ::|..||.|. :.....|.:.|||          ..|        |:|.::.:|.
  Fly   197 NQPLDMRHHRLRPICLPVQSYSFDHELGIVAGWG----------AQREGGFGTDTLREVDVVVLP 251

  Fly   239 MELCEQILARSGL-----PLHETNLCTGPLT-GGVSICTADSGGPLIQQCCEEHFEQANIVIGIV 297
            ...|     |:|.     .:.:..:|.|.:: ||...|:.|||||| |...:|...|..:. |||
  Fly   252 QSEC-----RNGTTYRPGQITDNMMCAGYISEGGKDACSGDSGGPL-QTTFDEQPGQYQLA-GIV 309

  Fly   298 SWGKMPCGQKNAPSVFVRVSAFTEWINQVISTATHIM 334
            ||| :.|.:..:|.|:.||:.:..|:........|.|
  Fly   310 SWG-VGCARPQSPGVYTRVNQYLRWLGSNTPGGCHCM 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 71/267 (27%)
Tryp_SPc 84..323 CDD:214473 70/264 (27%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 71/268 (26%)
Tryp_SPc 101..334 CDD:238113 70/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.