DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG11192

DIOPT Version :10

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:84 Identity:17/84 - (20%)
Similarity:31/84 - (36%) Gaps:32/84 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QRSPNASFN--PAHAQYACCFQQLHSNTGAILIAVFHIILCSGIFTWLVKCIATEKSRIELAAEI 79
            |.|||.:..  ||        ..:::..|.:           |:.|:| :...|:.:.:.||   
  Fly   249 QTSPNGTVTNIPA--------SMVNNQFGMV-----------GLLTFL-RAAETDPNLVTLA--- 290

  Fly    80 FLASLCLIAAIILLLGLKL 98
                   :...::.|||.|
  Fly   291 -------MGQDLMALGLNL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 4/15 (27%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 4/9 (44%)

Return to query results.
Submit another query.