DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Tmprss4

DIOPT Version :10

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:264 Identity:83/264 - (31%)
Similarity:124/264 - (46%) Gaps:47/264 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAG 141
            |.:.:...||:..|.|:.||||     ....|.|.|:|::.|||||||||......|.:..:.||
  Rat   243 TTRVVGGVEASADSWPWQVSIQ-----YNKQHVCGGSILDHHWILTAAHCFRKYLDVSSWKVRAG 302

  Fly   142 SHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPY-----DIALIYTKEPLVFDTYVQPATLPEQ 201
            |:.:    |.:.::.:.        ::::...||.     ||||:..|.||.|...|:|..||..
  Rat   303 SNKL----GNSPSLPVA--------KIFIAEPNPLQPKEKDIALVKLKMPLTFSGSVRPICLPFS 355

  Fly   202 DAQ--PEGYGTLYGW-------GNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETN 257
            |.:  |.....:.||       |.:|.|        |.:|::.::|...|....|..| .:....
  Rat   356 DEELIPTMPVWVIGWGFTEENGGKMSDT--------LLQASVQVIDSARCNAEDAYQG-EVTAGM 411

  Fly   258 LCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEW 322
            ||.|...||...|..||||||:.     |:::.. |:|||||| ..||..:.|.|:.:|:|:.:|
  Rat   412 LCAGTPQGGKDTCQGDSGGPLMY-----HYDKWQ-VVGIVSWG-YGCGSPSTPGVYTKVTAYLDW 469

  Fly   323 INQV 326
            |..|
  Rat   470 IYNV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 81/255 (32%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:470597
Tryp_SPc 245..470 CDD:214473 79/257 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.