DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and kappaTry

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:113/252 - (44%) Gaps:42/252 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PYVVSIQMMTPDQ-GLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKG---EA 152
            ||:||::....:: ..:|.|||.||:|..::|:|.||.........|.|||::..:...|   ..
  Fly    38 PYLVSLRYRRDNESSYMHECAGVIISEQALITSAQCLYGLPEETKLVAVAGANTRNGTDGFIYPV 102

  Fly   153 SNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATL--------PEQDAQPEGYG 209
            :|        :..|..|.......||.:      |:.||.:....|        ||:.|... ..
  Fly   103 AN--------WTHHPNYDPVTVDNDIGV------LLLDTTLDLTLLGISSIGIRPERPAVGR-LA 152

  Fly   210 TLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTG-PLTGGVSICTAD 273
            |:.|||........:|  :|::..:|::..|.|.||....  .:.|..:|.| .:.||...|..|
  Fly   153 TVAGWGYREEWGPSSY--KLEQTEVPVVSSEQCTQIYGAG--EVTERMICAGFVVQGGSDACQGD 213

  Fly   274 SGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVISTA 330
            :||||:..         ..::|:||||: .|.:.|.|:|:..|::|.:||.:.|:.|
  Fly   214 TGGPLVID---------GQLVGLVSWGR-GCARPNYPTVYCYVASFVDWIEETIAAA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 67/246 (27%)
Tryp_SPc 84..323 CDD:214473 65/243 (27%)
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 65/243 (27%)
Tryp_SPc 26..256 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.