DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG18563

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:244 Identity:67/244 - (27%)
Similarity:107/244 - (43%) Gaps:55/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHE--LY 169
            |:...|::|:...||||||...: :..|:.::|.....:.:...|....:.|.::..||||  ::
  Fly   156 VYLTGGSLISPKVILTAAHNTMN-KMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIF 219

  Fly   170 LGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYG-TLYGWGNVSMTAVPNYPHR----- 228
            ..|:|  ::|||:.|.|.|.:..:...|||.:.|..||.. |:.||..||       .|.     
  Fly   220 QSGIN--NVALIFVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVS-------SHDQSRMR 275

  Fly   229 -LQEANMPILDMELC-----------------EQILARSGLPLHETNLCTGPLTGGVSI-CTADS 274
             :::..:.:||...|                 ..|.|||.:   ..:.|.|  .||.:: |:...
  Fly   276 IIKKLELTVLDRTTCVAQFRNTTLGRNFDLHPSLICARSEI---NRDFCFG--GGGYALFCSLGD 335

  Fly   275 GGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            ..|.:       ||||    |||:|| |.|| .:.|.::..|:.|..||
  Fly   336 ENPHV-------FEQA----GIVAWG-MGCG-LDLPGIYTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 67/244 (27%)
Tryp_SPc 84..323 CDD:214473 65/242 (27%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 67/244 (27%)
Tryp_SPc 147..371 CDD:214473 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.