DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and SPH93

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:256 Identity:70/256 - (27%)
Similarity:119/256 - (46%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EATPHSAPYVVSIQMMTPDQGLVH---YCA-GTIINEHWILTAAHCLSSPQAVENSVIV-AGSHD 144
            :|.|...|:.|:|         .|   |.| |::|..:.:||.||.:.:   :|..::| ||..|
  Fly   251 QARPAQYPWAVAI---------FHNGQYLAGGSLIQPNVVLTVAHRVIT---IETELVVRAGDWD 303

  Fly   145 IHDQKGEASNIQMRHIDYYVRHE--LYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEG 207
            :...: |....:.|.::..|.||  .:..|.|  ::||::...|...:.:::...||..:....|
  Fly   304 LKSDR-EIFLSEQREVERAVIHEGFDFKSGAN--NLALLFLNSPFKLNDHIRTICLPTPNKSFAG 365

  Fly   208 YG-TLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGL----PLHETNLCTGPLTGGV 267
            .. |:.|||.:.... ..|...|::..:.:::..:||:.|..:.|    .|.:..:|.|...|. 
  Fly   366 RRCTVAGWGKMRYED-QRYSTVLKKVQLLVVNRNVCEKFLRSTRLGAKFELPKNIICAGGELGR- 428

  Fly   268 SICTADSGGPLIQQCCEEH---FEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325
            ..||.|.|..|......|:   :|||    |||:|| :.|||:..|:::..||.||.||.:
  Fly   429 DTCTGDGGSALFCSIGGENSGVYEQA----GIVNWG-VGCGQEGIPAIYTEVSKFTNWITE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 70/256 (27%)
Tryp_SPc 84..323 CDD:214473 68/252 (27%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 70/256 (27%)
Tryp_SPc 252..482 CDD:214473 68/251 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.