DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Phae2

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:316 Identity:131/316 - (41%)
Similarity:169/316 - (53%) Gaps:62/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LSTIASIMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWT 77
            |:||..:.|.:|..|..::..|..|..||                                    
  Fly     7 LATILLLAVCVSQGSGLALDQPEGRVVGG------------------------------------ 35

  Fly    78 KKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGS 142
                  :.|..:||||:||:|     .|..||||..|||.:|::||||||::...|..|.:||||
  Fly    36 ------KAAAANSAPYIVSMQ-----YGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGS 89

  Fly   143 HDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEG 207
            ..:   .|.||..|.|.|.:||.::||.||..||||.||||.....:...|.|..||....:|.|
  Fly    90 IAV---AGTASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVAPVKLPSSGVRPTG 151

  Fly   208 YGTLYGWGNVSMTAVPNYPHRLQEA-NMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICT 271
            ...|:|||:.|.|..|:||..|||| |:||:.::.|...|...|..:|.|||||||||||.|.||
  Fly   152 KADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVHTTNLCTGPLTGGTSFCT 216

  Fly   272 ADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI--NQ 325
            :||||||:         |.|::||||||||:||||.|:|||:|:||:|..||  ||
  Fly   217 SDSGGPLV---------QGNVLIGIVSWGKLPCGQPNSPSVYVQVSSFITWIAANQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 121/245 (49%)
Tryp_SPc 84..323 CDD:214473 117/239 (49%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 120/286 (42%)
Tryp_SPc 32..262 CDD:238113 121/288 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I7616
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 1 1.000 - - H133789
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26409
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 1 1.000 - - FOG0009978
OrthoInspector 1 1.000 - - mtm14829
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4905
98.830

Return to query results.
Submit another query.