DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Phae1

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:246 Identity:124/246 - (50%)
Similarity:156/246 - (63%) Gaps:20/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKG 150
            |..:||||.||:|     .|..||||.:|:|.:|::||||||::...|..|.:||||..:   .|
  Fly    42 AAVNSAPYAVSMQ-----YGGTHYCAASILNANWLVTAAHCLTNSNQVLGSTLVAGSIAV---DG 98

  Fly   151 EASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWG 215
            .||..|.|.|.|:|.::||.||..||||.:|||....|:...|.|.|||.....|.|...|||||
  Fly    99 TASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWG 163

  Fly   216 NVSMTAVPNYPHRLQEA-NMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLI 279
            :.|.|...:||..||.| |:||:.:..||..|...|..:|.||||||||||||||||:||||||:
  Fly   164 STSTTNTASYPSTLQVATNVPIISLSSCESALGTKGSDVHSTNLCTGPLTGGVSICTSDSGGPLV 228

  Fly   280 QQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI--NQVIS 328
                     |.|::||||||||:||||.|:|||:|:||:|..||  ||.:|
  Fly   229 ---------QGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWISANQQVS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 122/242 (50%)
Tryp_SPc 84..323 CDD:214473 119/237 (50%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 119/237 (50%)
Tryp_SPc 36..266 CDD:238113 121/240 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455579
Domainoid 1 1.000 173 1.000 Domainoid score I7616
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 1 1.000 - - H133789
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26409
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 1 1.000 - - FOG0009978
OrthoInspector 1 1.000 - - mtm14829
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4905
109.760

Return to query results.
Submit another query.