DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and TMPRSS7

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001382436.1 Gene:TMPRSS7 / 344805 HGNCID:30846 Length:843 Species:Homo sapiens


Alignment Length:314 Identity:82/314 - (26%)
Similarity:118/314 - (37%) Gaps:93/314 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPD 103
            |...||:.|.|.:.          ....|||.    .|               |:.||:..:.. 
Human   594 CTCSRSSSALHRII----------GGTDTLEG----GW---------------PWQVSLHFVGS- 628

  Fly   104 QGLVHYCAGTIINEHWILTAAHCL-------SSPQAVENSVIVAGSHDIHDQKGEASNIQ-MRHI 160
                .||..::|:..|:|:||||.       .:|......:.|         :|.|..:. :|.|
Human   629 ----AYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYV---------QGNAKFVSPVRRI 680

  Fly   161 DYYVRHELYLGGVNPYDIALIYTK--EPLVFDTYVQPATLPEQDAQPEGYGT-------LYGWGN 216
               |.||.|......|||||:...  .|......:||..:|     |.|...       :.|||.
Human   681 ---VVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIP-----PTGQRVRSGEKCWVTGWGR 737

  Fly   217 VSMTAVPNYPHR--------LQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTAD 273
                     .|.        ||:|.:.::|..||   ::..|: :....||.|.::|....|..|
Human   738 ---------RHEADNKGSLVLQQAEVELIDQTLC---VSTYGI-ITSRMLCAGIMSGKRDACKGD 789

  Fly   274 SGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            |||||   .|....:...|:.||||||. ..|:.|.|.|:.|||.|..||::.:
Human   790 SGGPL---SCRRKSDGKWILTGIVSWGH-GSGRPNFPGVYTRVSNFVPWIHKYV 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/266 (27%)
Tryp_SPc 84..323 CDD:214473 71/263 (27%)
TMPRSS7NP_001382436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..67
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.