DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG3355

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:238 Identity:77/238 - (32%)
Similarity:110/238 - (46%) Gaps:51/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 HY----CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVR--- 165
            ||    |.|::||:.::||||||:               |...||    ..|::..||...|   
  Fly    98 HYPRLFCGGSLINDRYVLTAAHCV---------------HGNRDQ----ITIRLLQIDRSSRDPG 143

  Fly   166 --HELYLGGVNP--------YDIALIYTKEPLVFDTYVQPATLPEQDAQPEG-YGTLYGWGNVSM 219
              .::....|:|        .|:||:..:.|:.....::|..|||.:...:| ...:.|||.:..
  Fly   144 IVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKE 208

  Fly   220 TAV-PNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPL-TGGVSICTADSGGPLIQQC 282
            ..| .||   |||.|:|::....|.|  .|....:.|..||.|.: .||...|..|||||||.. 
  Fly   209 GGVTSNY---LQEVNVPVITNAQCRQ--TRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVN- 267

  Fly   283 CEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQ 325
             |..::.|    |:||:| ..|.|||||.|:.|||.|.:||.:
  Fly   268 -EGRYKLA----GVVSFG-YGCAQKNAPGVYARVSKFLDWIRK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 77/238 (32%)
Tryp_SPc 84..323 CDD:214473 75/234 (32%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 75/234 (32%)
Tryp_SPc 76..305 CDD:238113 77/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.