DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG40160

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:299 Identity:78/299 - (26%)
Similarity:127/299 - (42%) Gaps:48/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLV 107
            |..|..:|..::....|:.:|.....|.|    ||...|       ||.             .|.
  Fly   149 RGCGVRNTGGLDFTLSGVSQNEAGFGEFP----WTVALL-------HSG-------------NLS 189

  Fly   108 HYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGG 172
            ::|||::|::..:||||||:.|.: ..:..:.||..|....| |....|.|.:...:.|..|...
  Fly   190 YFCAGSLIHKQVVLTAAHCVESLR-TGSFTVRAGEWDTQTMK-ERLPYQERSVQTVILHPDYNRR 252

  Fly   173 VNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLY--GWGNVSMTAVPNYPHRLQEANMP 235
            ...||.||:...:|:..|.::....||:||..|:...|.:  |||..:..::..|...::...:|
  Fly   253 SIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFSTGWGKDAFGSLGKYSSLMKRVPLP 317

  Fly   236 ILDMELCEQILARSGL----PLHETNLCTGPLTGGVSICTADSGGPLIQQCC------EEHFEQA 290
            |::...|:..|..:.|    .|..:.:|.|. ..|:..|..|.|.||   .|      |..::|.
  Fly   318 IVEFNSCQTRLRGTRLGPKFALDRSFICAGG-QRGIDTCQGDGGAPL---ACPRGSTRESRYQQT 378

  Fly   291 NIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329
                |||:|| :.|..: .|:.:..|:....||:|.:.|
  Fly   379 ----GIVAWG-IGCNDE-VPAAYANVALVRGWIDQQMLT 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 66/253 (26%)
Tryp_SPc 84..323 CDD:214473 64/250 (26%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 72/277 (26%)
Tryp_SPc 169..405 CDD:214473 70/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.