DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG3117

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:288 Identity:85/288 - (29%)
Similarity:121/288 - (42%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 PRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLS--SPQAV 133
            |.|..|.....||       ..|:....::||  |||             |||||.|:  ||   
  Fly   100 PNQFPWVTALFAK-------GSYLGGGSLITP--GLV-------------LTAAHILAGLSP--- 139

  Fly   134 ENSVIV-AGSHDIHDQKGEASNIQM-RHIDYYVRHEL--YLGGVNPYDIALIYTKEPLVFDTYVQ 194
             |.::| ||..|:  ...|..|..| |.:...:.||.  |..|.|  |:||::...|......:|
  Fly   140 -NDIMVRAGEWDL--SSSEKLNPPMDRQVIKIMEHEAFNYSSGAN--DLALLFLDSPFELRANIQ 199

  Fly   195 PATLPEQDAQ-PEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQIL----ARSGLPLH 254
            ...||..|.. .....|:.|||..|.|.| :.....|:.::|:::...|::.|    ..|...|.
  Fly   200 TIRLPIPDKTFDRRICTVAGWGMRSSTDV-DIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLP 263

  Fly   255 ETNLCTG--------PLTGGVSI-CTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAP 310
            .:.:|.|        .|.||.:: |:.|..        ...:|||    ||||:| :.|||.|.|
  Fly   264 ASLMCAGGEEGRDVCSLFGGFALFCSLDDD--------PNRYEQA----GIVSFG-VGCGQANVP 315

  Fly   311 SVFVRVSAFTEWIN----QVISTATHIM 334
            :.|..||.|.||||    ||:|...:::
  Fly   316 TTFTHVSKFMEWINPHLEQVLSVPGNML 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 77/265 (29%)
Tryp_SPc 84..323 CDD:214473 74/258 (29%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 80/272 (29%)
Tryp_SPc 95..328 CDD:214473 79/271 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.