DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG18557

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:252 Identity:69/252 - (27%)
Similarity:116/252 - (46%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EATPHSAPYVVSIQMMTPDQGLVHYC-AGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQ 148
            :|.|:..|:.|::.     |.|:::. |||::.|:.::|||| |...:.:.:..|:.|:.|:...
  Fly    89 QAKPNEFPWTVALM-----QNLINFFGAGTLVTENIVITAAH-LMLDKTINDFGIIGGAWDLKQL 147

  Fly   149 KGEASNIQMRHIDYYVRHELY--LGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTL 211
            .|:  .||.|.....|.|..:  :.|.|  :||||..:...|....:.|...|......:....|
  Fly   148 AGK--TIQWRTATRIVSHPDFNKMTGAN--NIALIVLETSFVMKPPIGPICWPTSGVSFDRERCL 208

  Fly   212 Y-GWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARS----GLPLHETNLCTGPLTGGVSICT 271
            . |||.....| .||.::.::.::||:....||.:|.|:    ...|..|.||.|. ..|...|.
  Fly   209 VAGWGRPDFLA-KNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG-ERGRDACI 271

  Fly   272 ADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
            .|.|.||:  |..........::|||:.| ..||.:|.|:::..:|....||.:.::
  Fly   272 GDGGSPLM--CPIPGHPAIYELVGIVNSG-FSCGLENVPALYTNISHMRPWIEKQLN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 69/248 (28%)
Tryp_SPc 84..323 CDD:214473 67/245 (27%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 69/248 (28%)
Tryp_SPc 90..320 CDD:214473 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.