DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG4271

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:220 Identity:62/220 - (28%)
Similarity:95/220 - (43%) Gaps:30/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 HYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGG 172
            |.|.|.:|:...:||||.|:.: :.|:...:..|:.||:  :|.    ::..:...|.||.|...
  Fly    42 HECGGAVIDSRIVLTAAQCVKN-KPVKRITVRVGTPDIY--RGG----RIIRVTALVVHENYKNW 99

  Fly   173 VNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNY--PHRLQEANMP 235
            .|  ||||::.::| |....|....|..::.....|.:..|||.   ..:.:|  ..:||.....
  Fly   100 DN--DIALLWLEKP-VLSVRVTKIPLATKEPSENEYPSNAGWGE---KLLESYVVTRKLQNGVTK 158

  Fly   236 ILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWG 300
            |....:|.:.|..   |:.|..||......  .||..|.||||:         .||.|:||...|
  Fly   159 IRPRSMCAEELVE---PVGEELLCAFYTEN--DICPGDYGGPLV---------LANKVVGIAVQG 209

  Fly   301 KMPCGQKNAPSVFVRVSAFTEWINQ 325
            . .||....||::..|..:.|||.:
  Fly   210 H-GCGFAVLPSLYTNVFHYLEWIEE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 62/220 (28%)
Tryp_SPc 84..323 CDD:214473 60/216 (28%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 62/220 (28%)
Tryp_SPc 19..231 CDD:214473 60/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.