DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG11911

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:245 Identity:103/245 - (42%)
Similarity:142/245 - (57%) Gaps:16/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQK 149
            ||.||||||:||  :.|......|.|.||:||:.||:|||||:|.|..:.   |:||.|    .:
  Fly    42 EAEPHSAPYIVS--LATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMS---IIAGLH----TR 97

  Fly   150 GEASNI-QMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYG 213
            .|...: |.|.:|:...||.|.|||.||||||::..|..:|:.:|||||||.::...||...|||
  Fly    98 AEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYG 162

  Fly   214 WGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPL 278
            ||. ..:.:.:....||.....||:.|.|::.|..|. |:.|:|:|:..|....|.|..||||||
  Fly   163 WGQ-PKSYIFSGAKTLQTVTTQILNYEECKEELPESA-PIAESNICSSSLQQSKSACNGDSGGPL 225

  Fly   279 IQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIS 328
            :.:......|    :|||||||.:|||..|.||::.:|||:.:||..:.|
  Fly   226 VVEFTNAPSE----LIGIVSWGYIPCGLANMPSIYTKVSAYIDWITNIQS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 102/241 (42%)
Tryp_SPc 84..323 CDD:214473 100/238 (42%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 102/241 (42%)
Tryp_SPc 37..266 CDD:214473 100/238 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.