DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG11912

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608517.1 Gene:CG11912 / 33205 FlyBaseID:FBgn0031248 Length:271 Species:Drosophila melanogaster


Alignment Length:275 Identity:101/275 - (36%)
Similarity:135/275 - (49%) Gaps:37/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 ISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSS 129
            :|.:..|:......:.:...||....|||:||:|..:..    |:|||::::|..|:||||||:.
  Fly    15 VSAISVPQPGFPEGRIINGYEAAKGEAPYIVSLQTTSNS----HFCAGSLLDEVTIVTAAHCLTY 75

  Fly   130 PQAVENSVIVAGSHDIHDQKGEASNIQMRHID--YYVRHELYLGGVNPYDIALIYTKEPLVFD-- 190
            .|    ...|||:|...||:    |:|:|...  .||.||.|.|||.|.||.||..||...||  
  Fly    76 NQ----GQAVAGAHSRTDQE----NVQIRKFTNAQYVIHENYGGGVGPNDIGLILLKEEDAFDLN 132

  Fly   191 -------TYVQPATLPEQDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILAR 248
                   ..|...:||.:..|....|.|||||..:...:   |..||:.:..|:|...|:..|. 
  Fly   133 AVARDGSNPVSAVSLPSKTFQGTSDGYLYGWGRDNSGLL---PLNLQKLDAIIVDYNECKAALP- 193

  Fly   249 SGLPLHETNLCT---GPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAP 310
            |...|.|||:||   |...|.   |..||||||:.|......|    :|||||||..||.....|
  Fly   194 SNNSLAETNVCTHTPGKADGS---CNGDSGGPLVSQSSSRGAE----LIGIVSWGYTPCLSTTYP 251

  Fly   311 SVFVRVSAFTEWINQ 325
            ||:..||:|..||::
  Fly   252 SVYTSVSSFLPWIDE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 99/256 (39%)
Tryp_SPc 84..323 CDD:214473 97/252 (38%)
CG11912NP_608517.1 Tryp_SPc 29..264 CDD:214473 97/257 (38%)
Tryp_SPc 30..267 CDD:238113 99/260 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.