DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG14227

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:341 Identity:74/341 - (21%)
Similarity:124/341 - (36%) Gaps:101/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IASIMVVLSSASSGSIQLPTV---RKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWT 77
            ||:::::.:|...||.:....   .:||......|..|                         |.
  Fly     5 IAALLILFASLFLGSREGSAFLLDAECGRSLPTNAKLT-------------------------WW 44

  Fly    78 KKFLAKREATPHSAPYVVSIQMMTPDQGLVH---YCAGTIINEHWILTAAHCLSSPQAVENSVIV 139
            ..|.:..:.  .:.|::||:        :|:   .|:|::||..::||||||:..    |...:.
  Fly    45 NYFDSSTDI--QANPWIVSV--------IVNGKAKCSGSLINHRFVLTAAHCVFR----EAMQVH 95

  Fly   140 AGSHDIHD------QKGEASNIQMRHIDYYVRHELYLGGV--NPYDIALIYTKEPLVFDTYVQPA 196
            .|..|..:      .....||.....||..:.|..: |.:  ..|||.|:..:..:.:..:|:|.
  Fly    96 LGDFDAWNPGQNCSSGARLSNAYCVRIDKKIVHAGF-GKIQAQQYDIGLLRMQHAVQYSDFVRPI 159

  Fly   197 TL--PEQDAQPEGYGTLYGWGNVSMTAVPNY---PHRLQEANMPILDMELC-----EQILARSGL 251
            .|  .|..|..:.: .|..||    |...::   |..|:.:....:|.|||     :|:      
  Fly   160 CLLINEPVAAIDRF-QLTVWG----TTAEDFRSIPRVLKHSVGDRIDRELCTLKFQQQV------ 213

  Fly   252 PLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIV---------IGIVSWGKMPCGQK 307
              .|:.:|....|.  ..|..|||||.          .|.|:         .||:.:|...|.  
  Fly   214 --DESQICVHTETS--HACKGDSGGPF----------SAKILYGGTYRTFQFGIIIFGLSSCA-- 262

  Fly   308 NAPSVFVRVSAFTEWI 323
             ..||...|:.:.:||
  Fly   263 -GLSVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 63/270 (23%)
Tryp_SPc 84..323 CDD:214473 61/268 (23%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 61/260 (23%)
Tryp_SPc 57..277 CDD:238113 61/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.