DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG9673

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:287 Identity:82/287 - (28%)
Similarity:126/287 - (43%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTI 114
            |:.:.|..:||    |.:.||..|    .:.|...:......|:..|::     ....|.|:|.|
  Fly     7 TLGLGLLIFGL----ILSAEASPQ----GRILGGEDVAQGEYPWSASVR-----YNKAHVCSGAI 58

  Fly   115 INEHWILTAAHCLSSP--QAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYD 177
            |:.:.|||||||:||.  ..|:.|.:......|:...| .|.:.::.:   :.|..|  |...:|
  Fly    59 ISTNHILTAAHCVSSVGITPVDASTLAVRLGTINQYAG-GSIVNVKSV---IIHPSY--GNFLHD 117

  Fly   178 IALIYTKEPLVFDTYVQPATLP--------EQDAQ-PEGYGT-LYGWGNVS-MTAVPNYPHRLQE 231
            ||::...|.|||...:|...||        :.||: |.|... :.|||.:| .||    .::.|:
  Fly   118 IAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTA----SYKQQK 178

  Fly   232 ANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGI 296
            ||...|...|||.   .:|.. :|:.:|.. ...|..||..|:|..:|        :...::.|:
  Fly   179 ANYNTLSRSLCEW---EAGYG-YESVVCLS-RAEGEGICRGDAGAAVI--------DDDKVLRGL 230

  Fly   297 VSWGKMPCGQKNAPSVFVRVSAFTEWI 323
            .|:...|||.| .|.|..|||.:..||
  Fly   231 TSFNFGPCGSK-YPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/253 (29%)
Tryp_SPc 84..323 CDD:214473 71/251 (28%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 72/256 (28%)
Tryp_SPc 29..259 CDD:238113 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.