DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG33160

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:324 Identity:66/324 - (20%)
Similarity:124/324 - (38%) Gaps:75/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RCIYSVLLSTIASIMVVLSSASSGSIQLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEA 70
            ||:.|:.|..|.                       |..||..||..::.:.. .::...:|::: 
  Fly     4 RCLTSLFLVQIL-----------------------GFHSAVYAHPDSVQIQP-RIIGGHVSSIK- 43

  Fly    71 PRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVEN 135
                  .:|:|               :|:.|.::    .|.|:::...|::|||||:.:..  :|
  Fly    44 ------EEKYL---------------VQVTTSEE----LCGGSLVKPRWVITAAHCVYNKN--KN 81

  Fly   136 SVIVAGSHDIHDQKGEASNIQMRHIDYY-VRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLP 199
            ...:.|.  ..:|.|..:.|  |.:||. :|.:.....:| .|:|.:.....:: ...::...|.
  Fly    82 DFKIYGG--ASNQAGPYAVI--RTVDYIAIRPDFNRKTLN-MDVAALRLNSDMI-GANIETIPLA 140

  Fly   200 EQDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGL-PLHETNLCTGPL 263
            .|.........:.|||.::..|... ..|:....:|:.....|  :.|..|: .:..:.:|...|
  Fly   141 AQSVPARALVKVSGWGFLTADATKT-AERVHSVLVPMWSRASC--VSAFRGIHRITRSMVCAARL 202

  Fly   264 TGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ....| |..||||||:.:         ..:.||||:| ..|... .|.::..|....:|..:|:
  Fly   203 YKKDS-CDGDSGGPLVYR---------GQLAGIVSFG-YGCASA-LPGIYTSVPEIRDWFQRVV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 52/243 (21%)
Tryp_SPc 84..323 CDD:214473 51/240 (21%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 54/264 (20%)
Tryp_SPc 34..253 CDD:238113 55/267 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.