DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG33159

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:256 Identity:69/256 - (26%)
Similarity:110/256 - (42%) Gaps:35/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSH 143
            :.:..:|.|....||:|.::     |.....|.|::|:...:|:||||:...|. |...:.||:.
  Fly    25 RIVGGKETTISEVPYLVYLR-----QNGYFICGGSLISSRAVLSAAHCVYGSQP-EGFTVHAGAS 83

  Fly   144 DIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEG- 207
            .:..:.....|:.|.|..     ..|.......|:||:..:|.:|. |..:.||:......||| 
  Fly    84 RLDQEAPVVRNVVMFHTS-----PSYSATNFDMDVALLQLQEVVVL-TPGKVATISPCRNPPEGN 142

  Fly   208 -YGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGL-PLHETNLCTGPLTGGVSIC 270
             |..:.|||   :|...|.....|.....:..:...|..::.||. .|.::.||.. :.|....|
  Fly   143 AYARISGWG---VTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAA-VRGLRDSC 203

  Fly   271 TADSGGPLIQ--QCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSA--FTEWINQVI 327
            :.||||||:.  |.|           |||||| ..|.:.:.|.|:..|::  ..|:|.|.:
  Fly   204 SGDSGGPLVYRGQVC-----------GIVSWG-FGCARPSFPGVYTNVASERVHEFIEQTL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 68/248 (27%)
Tryp_SPc 84..323 CDD:214473 67/245 (27%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 66/243 (27%)
Tryp_SPc 26..251 CDD:238113 68/252 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455645
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.