DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and CG33127

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_787956.1 Gene:CG33127 / 318893 FlyBaseID:FBgn0053127 Length:284 Species:Drosophila melanogaster


Alignment Length:239 Identity:67/239 - (28%)
Similarity:106/239 - (44%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASN 154
            :.||:||:.:....  ..|.|..:||.:.|:||||||:...:......:....:.....:...:.
  Fly    52 NVPYLVSLSLTRAT--YTHLCGASIIGKRWLLTAAHCVDELRTFNGDAVGTPVYAGIINRSNVTA 114

  Fly   155 IQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE-QDAQPEGYGTLYGWGNVS 218
            .|:|::|:...|..:.|.....:|||::..|...::..||...||: .|.........||||...
  Fly   115 AQVRYVDFASTHRSFNGNAGSDNIALLHVSESFEYNARVQQIALPDINDDYSNKTAAAYGWGLTD 179

  Fly   219 MTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCC 283
            ... ..|...||.|..|:|:...|:::|. :..||....:|:     .|..|..|.|.|||....
  Fly   180 PDG-DEYSKELQYAFAPLLNSTGCKELLP-ADAPLTAQQVCS-----QVKTCYGDGGTPLIYWPI 237

  Fly   284 EEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ....|    ::|:.||..||||..|.|:|:..|..:..||:|.|
  Fly   238 TGPAE----LVGLGSWSYMPCGYANRPTVYTSVPPYIGWIHQTI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 65/236 (28%)
Tryp_SPc 84..323 CDD:214473 63/233 (27%)
CG33127NP_787956.1 Tryp_SPc 41..276 CDD:238113 65/236 (28%)
Tryp_SPc 41..273 CDD:214473 63/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQSN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D36714at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.